PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_5AS_6F02C9967.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family bZIP
Protein Properties Length: 180aa    MW: 19282.2 Da    PI: 9.1287
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_5AS_6F02C9967.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_128.24.2e-09549852
                           HCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                 bZIP_1  8 rrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleel 52
                           +r   NR A r++R++Kka ++ Lee+v +L+a Nk+L k+l++ 
  Traes_5AS_6F02C9967.1  5 KRPSGNRAAVRKYREKKKAHTALLEEEVVQLKALNKQLLKKLQNH 49
                           55566**********************************999874 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003385.0E-5165IPR004827Basic-leucine zipper domain
SuperFamilySSF579595.25E-7349No hitNo description
PfamPF077161.9E-13355IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.6E-11466No hitNo description
CDDcd146861.94E-111048No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 180 aa     Download sequence    Send to blast
GASKKRPSGN RAAVRKYREK KKAHTALLEE EVVQLKALNK QLLKKLQNHA ALEAEAARLR  60
CLLVDIRGRI DGEIGTFPYQ RPVKNVDLVS GVDQGGFLGS AQVMNSCDFR CNDQMYCNTG  120
MQMRTMGDDG AMSGQVFGQG TGDIANIQCI GGVKSGFTMP PGCGGMGTLP SGCLPSSEKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006656494.11e-101PREDICTED: uncharacterized protein LOC102721653
SwissprotQ8VY766e-41BZP19_ARATH; Basic leucine zipper 19
TrEMBLW5F4Y21e-131W5F4Y2_WHEAT; Uncharacterized protein
STRINGMLOC_60894.11e-107(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP41753572
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35040.12e-25bZIP family protein
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]